PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KZV19537.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Gesneriaceae; Didymocarpoideae; Trichosporeae; Loxocarpinae; Dorcoceras
Family WOX
Protein Properties Length: 279aa    MW: 31760.8 Da    PI: 8.3864
Description WOX family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KZV19537.1genomeCNUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox672.5e-2173132357
                 --SS--HHHHHHHHHHHHH.SSS--HHHHHHHHHHC....TS-HHHHHHHHHHHHHHHHC CS
    Homeobox   3 kRttftkeqleeLeelFek.nrypsaeereeLAkkl....gLterqVkvWFqNrRakekk 57 
                 +R+++t+eql++Lee++++  r+psae+++++A +l    +++ ++V++WFqN++a+e++
  KZV19537.1  73 TRWNPTPEQLQALEEMYRRgIRTPSAEQIRQIAGRLrrfgKIEGKNVFYWFQNHKARERQ 132
                 8*****************99**************************************97 PP

2Wus_type_Homeobox1123.2e-3672134365
  Wus_type_Homeobox   3 rtRWtPtpeQikiLeelyksGlrtPnkeeiqritaeLeeyGkiedkNVfyWFQNrkaRerqkq 65 
                        +tRW+PtpeQ++ Lee+y++G+rtP++e+i++i+ +L+++Gkie+kNVfyWFQN+kaRerqk+
         KZV19537.1  72 STRWNPTPEQLQALEEMYRRGIRTPSAEQIRQIAGRLRRFGKIEGKNVFYWFQNHKARERQKK 134
                        79***********************************************************96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003891.3E-470137IPR001356Homeobox domain
CDDcd000864.48E-773134No hitNo description
SuperFamilySSF466899.64E-1373138IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.606.7E-973132IPR009057Homeodomain-like
PfamPF000466.3E-1973132IPR001356Homeobox domain
PROSITE profilePS5007111.28978133IPR001356Homeobox domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 279 aa     Download sequence    Send to blast
MVESNNHFKD VETTIEYPVY SKKRRQLMPR MPPISDCSTG SMSGNLSAFQ TPCCCNHDSN  60
ILAGYDALPL VSTRWNPTPE QLQALEEMYR RGIRTPSAEQ IRQIAGRLRR FGKIEGKNVF  120
YWFQNHKARE RQKKRRQLEL LSAKQMDCVQ SKETGFSKRY MHSEHPKKLS GPSNCGTPSE  180
GSVAKHRAVE SECETVAQEN ENTFCALNLS ISLASKADDL KNSEGGIQEN NRVLRLFPVG  240
SIIDSEIVGT IEREDGVRRN YGPDSRVDYE FFEFLPTKN
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011070619.15e-63PREDICTED: WUSCHEL-related homeobox 1-like
TrEMBLA0A022QW666e-58A0A022QW66_ERYGU; Uncharacterized protein
STRINGGLYMA05G33850.23e-42(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA46812342
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G18010.18e-36WUSCHEL related homeobox 1